PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA13904
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family G2-like
Protein Properties Length: 315aa    MW: 34552.9 Da    PI: 9.1419
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA13904genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.38.2e-2970121253
                    G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkY 53 
                                prlrWtp+LH++F +ave+LGG+e+AtPk il+lm+v g+t++hvkSHLQ++
  Tp57577_TGAC_v2_mRNA13904  70 PRLRWTPDLHRCFAHAVERLGGEERATPKLILQLMNVRGITISHVKSHLQRH 121
                                8*************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-2766121IPR009057Homeodomain-like
SuperFamilySSF466894.3E-1468121IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-2170120IPR006447Myb domain, plants
PfamPF002494.2E-871121IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MKSKIESSTL KESSTQTMSS SSSSLVSGVV DNNPSYPSEV RTVHHRFNSG HSNTSFRPPA  60
VRPYVRSRMP RLRWTPDLHR CFAHAVERLG GEERATPKLI LQLMNVRGIT ISHVKSHLQR  120
HETGADDSRY NINPPLMYRG MKQELMIQEA RKNDMAAGLL ASTNSSSALV PSCQQSPGQT  180
QNSRNACESE SYNGNQVNES VIICNGDHEQ KMHTYIIFEG ILGNQTVQAN KRNQAREDKR  240
VNEEDTLSLS TSSKAPITCL ASSFRKFGGV GEEMKLLHHL HSYGGGAGGN IGGGYVYTLV  300
VEWVVVLVAV LAAV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013462843.12e-79myb-like DNA-binding domain, shaqkyf class protein
TrEMBLA0A072V6D02e-79A0A072V6D0_MEDTR; Myb-like DNA-binding domain, shaqkyf class protein
STRINGGLYMA09G00685.19e-67(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF93812840
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.16e-31G2-like family protein